| Brand: | Abnova |
| Reference: | H00064582-M01 |
| Product name: | GPR135 monoclonal antibody (M01), clone 1H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GPR135. |
| Clone: | 1H5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64582 |
| Gene name: | GPR135 |
| Gene alias: | HUMNPIIY20 |
| Gene description: | G protein-coupled receptor 135 |
| Genbank accession: | NM_022571 |
| Immunogen: | GPR135 (NP_072093, 391 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NPNISMLLGRNREEGYRTRNVDAFLPSQGPGLQARSRSRLRNRYANRLGACNRMSSSNPASGVAGDVAMWARKNPVVLFCREGPPEPVTAVTKQPKSEAGDTS |
| Protein accession: | NP_072093 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to GPR135 on MCF-7 cell . [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |