CLEC7A MaxPab mouse polyclonal antibody (B03) View larger

CLEC7A MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC7A MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CLEC7A MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00064581-B03
Product name: CLEC7A MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human CLEC7A protein.
Gene id: 64581
Gene name: CLEC7A
Gene alias: BGR|CLECSF12|DECTIN1
Gene description: C-type lectin domain family 7, member A
Genbank accession: BC013385
Immunogen: CLEC7A (AAH13385, 1 a.a. ~ 77 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG
Protein accession: AAH13385
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064581-B03-13-15-1.jpg
Application image note: Western Blot analysis of CLEC7A expression in transfected 293T cell line (H00064581-T05) by CLEC7A MaxPab polyclonal antibody.

Lane 1: CLEC7A transfected lysate(8.58 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLEC7A MaxPab mouse polyclonal antibody (B03) now

Add to cart