No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00064432-M01 |
| Product name: | MRPS25 monoclonal antibody (M01), clone 3E6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MRPS25. |
| Clone: | 3E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64432 |
| Gene name: | MRPS25 |
| Gene alias: | DKFZp313H0817|FLJ00023|MRP-S25|RPMS25 |
| Gene description: | mitochondrial ribosomal protein S25 |
| Genbank accession: | BC003590 |
| Immunogen: | MRPS25 (AAH03590, 1 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD |
| Protein accession: | AAH03590 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | MRPS25 monoclonal antibody (M01), clone 3E6. Western Blot analysis of MRPS25 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |