MRPS25 purified MaxPab mouse polyclonal antibody (B01P) View larger

MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00064432-B01P
Product name: MRPS25 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MRPS25 protein.
Gene id: 64432
Gene name: MRPS25
Gene alias: DKFZp313H0817|FLJ00023|MRP-S25|RPMS25
Gene description: mitochondrial ribosomal protein S25
Genbank accession: NM_022497
Immunogen: MRPS25 (NP_071942.1, 1 a.a. ~ 173 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Protein accession: NP_071942.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00064432-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MRPS25 expression in transfected 293T cell line (H00064432-T02) by MRPS25 MaxPab polyclonal antibody.

Lane 1: MRPS25 transfected lysate(19.03 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MRPS25 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart