Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRAF1 (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about PRAF1 (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00064425-P01 |
| Product name: | PRAF1 (Human) Recombinant Protein (P01) |
| Product description: | Human PRAF1 full-length ORF ( NP_071935.1, 1 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 64425 |
| Gene name: | POLR1E |
| Gene alias: | FLJ13390|FLJ13970|PAF53|PRAF1|RP11-405L18.3 |
| Gene description: | polymerase (RNA) I polypeptide E, 53kDa |
| Genbank accession: | NM_022490.1 |
| Immunogen sequence/protein sequence: | MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDFQIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRRVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT |
| Protein accession: | NP_071935.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Repression of rRNA transcription by PARIS contributes to Parkinson's disease.Kang H, Shin JH Neurobiol Dis. 2014 Oct 11. pii: S0969-9961(14)00296-4. doi: 10.1016/j.nbd.2014.10.003. |