Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HHIP monoclonal antibody (M01), clone 5D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about HHIP monoclonal antibody (M01), clone 5D11
| Brand: | Abnova |
| Reference: | H00064399-M01 |
| Product name: | HHIP monoclonal antibody (M01), clone 5D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HHIP. |
| Clone: | 5D11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 64399 |
| Gene name: | HHIP |
| Gene alias: | FLJ20992|FLJ90230|HIP|STQTL12 |
| Gene description: | hedgehog interacting protein |
| Genbank accession: | NM_022475 |
| Immunogen: | HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ |
| Protein accession: | NP_071920 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Role of hedgehog signaling in malignant pleural mesothelioma.Shi Y, Moura U, Opitz I, Soltermann A, Rehrauer H, Thies S, Weder W, Stahel RA, Felley-Bosco E. Clin Cancer Res. 2012 Sep 1;18(17):4646-56. Epub 2012 Jun 25. |