Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MPP5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MPP5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00064398-A01 |
| Product name: | MPP5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MPP5. |
| Gene id: | 64398 |
| Gene name: | MPP5 |
| Gene alias: | FLJ12615|PALS1 |
| Gene description: | membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) |
| Genbank accession: | NM_022474 |
| Immunogen: | MPP5 (NP_071919, 79 a.a. ~ 177 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS |
| Protein accession: | NP_071919 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The multi-PDZ domain protein-1 (MUPP-1) expression regulates cellular levels of the PALS-1/PATJ polarity complex.Assemat E, Crost E, Ponserre M, Wijnholds J, Le Bivic A, Massey-Harroche D Exp Cell Res. 2013 Jul 20. pii: S0014-4827(13)00300-5. doi: 10.1016/j.yexcr.2013.07.011. |