No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00064324-M08 |
| Product name: | NSD1 monoclonal antibody (M08), clone 4F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NSD1. |
| Clone: | 4F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64324 |
| Gene name: | NSD1 |
| Gene alias: | ARA267|DKFZp666C163|FLJ10684|FLJ22263|FLJ44628|KMT3B|SOTOS|STO |
| Gene description: | nuclear receptor binding SET domain protein 1 |
| Genbank accession: | NM_022455 |
| Immunogen: | NSD1 (NP_071900, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT |
| Protein accession: | NP_071900 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged NSD1 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Regulation of NF-kappaB by NSD1/FBXL11-dependent reversible lysine methylation of p65.Lu T, Jackson MW, Wang B, Yang M, Chance MR, Miyagi M, Gudkov AV, Stark GR. Proc Natl Acad Sci U S A. 2010 Jan 5;107(1):46-51. Epub 2009 Dec 22. |