Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF323 monoclonal antibody (M03), clone 4F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Tr |
More info about ZNF323 monoclonal antibody (M03), clone 4F7
| Brand: | Abnova |
| Reference: | H00064288-M03 |
| Product name: | ZNF323 monoclonal antibody (M03), clone 4F7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZNF323. |
| Clone: | 4F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64288 |
| Gene name: | ZNF323 |
| Gene alias: | FLJ23407|ZNF20-Lp|ZNF310P|dJ874C20.2 |
| Gene description: | zinc finger protein 323 |
| Genbank accession: | BC008490 |
| Immunogen: | ZNF323 (AAH08490, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNTGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLRKHQKIHTGERP |
| Protein accession: | AAH08490 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZNF323 expression in transfected 293T cell line by ZNF323 monoclonal antibody (M03), clone 4F7. Lane 1: ZNF323 transfected lysate(47.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |