Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MS4A6A monoclonal antibody (M02), clone 2D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about MS4A6A monoclonal antibody (M02), clone 2D12
| Brand: | Abnova |
| Reference: | H00064231-M02 |
| Product name: | MS4A6A monoclonal antibody (M02), clone 2D12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MS4A6A. |
| Clone: | 2D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64231 |
| Gene name: | MS4A6A |
| Gene alias: | 4SPAN3|4SPAN3.2|CD20L3|CDA01|MGC131944|MGC22650|MS4A6|MST090|MSTP090 |
| Gene description: | membrane-spanning 4-domains, subfamily A, member 6A |
| Genbank accession: | BC022854 |
| Immunogen: | MS4A6A (AAH22854, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS |
| Protein accession: | AAH22854 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (52.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MS4A6A expression in transfected 293T cell line by MS4A6A monoclonal antibody (M02), clone 2D12. Lane 1: MS4A6A transfected lysate(26.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |