| Brand: | Abnova |
| Reference: | H00064211-M01A |
| Product name: | LHX5 monoclonal antibody (M01A), clone 1D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX5. |
| Clone: | 1D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64211 |
| Gene name: | LHX5 |
| Gene alias: | MGC129689 |
| Gene description: | LIM homeobox 5 |
| Genbank accession: | NM_022363 |
| Immunogen: | LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE |
| Protein accession: | NP_071758 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |