No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00064151-M01 |
| Product name: | HCAP-G monoclonal antibody (M01), clone 4B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HCAP-G. |
| Clone: | 4B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64151 |
| Gene name: | NCAPG |
| Gene alias: | CAPG|CHCG|FLJ12450|HCAP-G|MGC126525|NY-MEL-3 |
| Gene description: | non-SMC condensin I complex, subunit G |
| Genbank accession: | BC000827 |
| Immunogen: | HCAP-G (AAH00827, 336 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS |
| Protein accession: | AAH00827 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to HCAP-G on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Combined functional genome survey of therapeutic targets for hepatocellular carcinoma.Satow R, Shitashige M, Kanai Y, Takeshita F, Ojima H, Jigami T, Honda K, Kosuge T, Ochiya T, Hirohashi S, Yamada T. Clin Cancer Res. 2010 May 1;16(9):2518-28. Epub 2010 Apr 13. |