Cart 67 Product Products 27 010,06 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD15...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 010,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 67 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 010,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 010,06 €
Data sheet of PARVG monoclonal antibody (M01A), clone 4E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about PARVG monoclonal antibody (M01A), clone 4E1
| Brand: | Abnova |
| Reference: | H00064098-M01A |
| Product name: | PARVG monoclonal antibody (M01A), clone 4E1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PARVG. |
| Clone: | 4E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 64098 |
| Gene name: | PARVG |
| Gene alias: | - |
| Gene description: | parvin, gamma |
| Genbank accession: | BC034406 |
| Immunogen: | PARVG (AAH34406, 1 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN |
| Protein accession: | AAH34406 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (62.15 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PARVG monoclonal antibody (M01A), clone 4E1 Western Blot analysis of PARVG expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |