No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00064072-A01 |
Product name: | CDH23 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CDH23. |
Gene id: | 64072 |
Gene name: | CDH23 |
Gene alias: | DFNB12|DKFZp434P2350|FLJ00233|FLJ36499|KIAA1774|KIAA1812|MGC102761|USH1D |
Gene description: | cadherin-like 23 |
Genbank accession: | NM_022124 |
Immunogen: | CDH23 (NP_071407, 29 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI |
Protein accession: | NP_071407 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Cadherin-23 Mediates Heterotypic Cell-Cell Adhesion between Breast Cancer Epithelial Cells and Fibroblasts.Apostolopoulou M, Ligon L. PLoS One. 2012;7(3):e33289. Epub 2012 Mar 7. |