| Brand: | Abnova |
| Reference: | H00063973-M12 |
| Product name: | NEUROG2 monoclonal antibody (M12), clone 1D2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NEUROG2. |
| Clone: | 1D2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 63973 |
| Gene name: | NEUROG2 |
| Gene alias: | Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2 |
| Gene description: | neurogenin 2 |
| Genbank accession: | NM_024019 |
| Immunogen: | NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG |
| Protein accession: | NP_076924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |