View larger

P53AIP1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of P53AIP1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00063970-A01
Product name:	P53AIP1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant P53AIP1.
Gene id:	63970
Gene name:	P53AIP1
Gene alias:	-
Gene description:	p53-regulated apoptosis-inducing protein 1
Genbank accession:	NM_022112
Immunogen:	P53AIP1 (NP_071395, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Protein accession:	NP_071395
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.99 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Anti-apoptotic roles for the mutant p53R248Q through suppression of p53-regulated apoptosis-inducing protein 1 in the RA-derived fibroblast-like synoviocyte cell line MH7A.Igarashi H, Hirano H, Yahagi A, Saika T, Ishihara K. Clin Immunol. 2014 Jan;150(1):12-21.