Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CIDEC purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CIDEC purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00063924-B01P |
| Product name: | CIDEC purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CIDEC protein. |
| Gene id: | 63924 |
| Gene name: | CIDEC |
| Gene alias: | CIDE-3|FLJ20871|Fsp27 |
| Gene description: | cell death-inducing DFFA-like effector c |
| Genbank accession: | BC016851 |
| Immunogen: | CIDEC (AAH16851, 1 a.a. ~ 238 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ |
| Protein accession: | AAH16851 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CIDEC expression in transfected 293T cell line (H00063924-T01) by CIDEC MaxPab polyclonal antibody. Lane 1: CIDEC transfected lysate(26.29 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes.Ito M, Nagasawa M, Omae N, Ide T, Akasaka Y, Murakami K. J Lipid Res. 2011 Jun 2. [Epub ahead of print] |