| Brand: | Abnova |
| Reference: | H00060675-A01 |
| Product name: | PROK2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PROK2. |
| Gene id: | 60675 |
| Gene name: | PROK2 |
| Gene alias: | BV8|KAL4|MIT1|PK2 |
| Gene description: | prokineticin 2 |
| Genbank accession: | NM_021935 |
| Immunogen: | PROK2 (NP_068754, 20 a.a. ~ 108 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
| Protein accession: | NP_068754 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The prokineticin receptor-1 (GPR73) promotes cardiomyocyte survival and angiogenesis.Urayama K, Guilini C, Messaddeq N, Hu K, Steenman M, Kurose H, Ert G, Nebigil CG. FASEB J. 2007 Sep;21(11):2980-93. Epub 2007 Apr 18. |