No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00060626-M01 |
| Product name: | RIC8A monoclonal antibody (M01), clone 1H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RIC8A. |
| Clone: | 1H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 60626 |
| Gene name: | RIC8A |
| Gene alias: | MGC104517|MGC131931|MGC148073|MGC148074|RIC8|synembryn |
| Gene description: | resistance to inhibitors of cholinesterase 8 homolog A (C. elegans) |
| Genbank accession: | NM_021932 |
| Immunogen: | RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS |
| Protein accession: | NP_068751.4 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | RIC8A monoclonal antibody (M01), clone 1H6. Western Blot analysis of RIC8A expression in K-562. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |