No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00060489-A01 |
| Product name: | APOBEC3G polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant APOBEC3G. |
| Gene id: | 60489 |
| Gene name: | APOBEC3G |
| Gene alias: | ARP9|CEM15|FLJ12740|MDS019|bK150C2.7|dJ494G10.1 |
| Gene description: | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
| Genbank accession: | NM_021822 |
| Immunogen: | APOBEC3G (NP_068594, 80 a.a. ~ 181 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY |
| Protein accession: | NP_068594 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |