View larger

MRPS35 purified MaxPab mouse polyclonal antibody (B02P)

Reference:

Condition: New product

Data sheet of MRPS35 purified MaxPab mouse polyclonal antibody (B02P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	WB-Ti,WB-Tr

More info about MRPS35 purified MaxPab mouse polyclonal antibody (B02P)

Brand:	Abnova
Reference:	H00060488-B02P
Product name:	MRPS35 purified MaxPab mouse polyclonal antibody (B02P)
Product description:	Mouse polyclonal antibody raised against a full-length human MRPS35 protein.
Gene id:	60488
Gene name:	MRPS35
Gene alias:	DKFZp762P093\|HDCMD11P\|MDS023\|MGC104278\|MRP-S28\|MRPS28
Gene description:	mitochondrial ribosomal protein S35
Genbank accession:	NM_021821
Immunogen:	MRPS35 (NP_068593.2, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Protein accession:	NP_068593.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of MRPS35 expression in transfected 293T cell line (H00060488-T02) by MRPS35 MaxPab polyclonal antibody. Lane 1: MRPS35 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy MRPS35 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart