| Brand: | Abnova |
| Reference: | H00060485-M02 |
| Product name: | SAV1 monoclonal antibody (M02), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SAV1. |
| Clone: | 3B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 60485 |
| Gene name: | SAV1 |
| Gene alias: | SAV|WW45|WWP4 |
| Gene description: | salvador homolog 1 (Drosophila) |
| Genbank accession: | NM_021818 |
| Immunogen: | SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF |
| Protein accession: | NP_068590 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SAV1 monoclonal antibody (M02), clone 3B2 Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Hippo signaling mediates proliferation, invasiveness and metastatic potential of clear cell renal cell carcinoma.Schutte U, Bisht S, Heukamp LC, Kebschull M, Florin A, Haarmann J, Hoffmann P, Bendas G, Buettner R, Brossart P, Feldmann G. Translational Oncology Volume 7, Issue 2, April 2014, Pages 309â321 |