No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00060437-M04 |
Product name: | CDH26 monoclonal antibody (M04), clone 6C10 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDH26. |
Clone: | 6C10 |
Isotype: | IgG2b Kappa |
Gene id: | 60437 |
Gene name: | CDH26 |
Gene alias: | VR20 |
Gene description: | cadherin-like 26 |
Genbank accession: | NM_021810.3 |
Immunogen: | CDH26 (NP_068582.2, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS |
Protein accession: | NP_068582.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | CDH26 monoclonal antibody (M04), clone 6C10. Western Blot analysis of CDH26 expression in HeLa. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |