| Brand: | Abnova |
| Reference: | H00060437-M04 |
| Product name: | CDH26 monoclonal antibody (M04), clone 6C10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDH26. |
| Clone: | 6C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 60437 |
| Gene name: | CDH26 |
| Gene alias: | VR20 |
| Gene description: | cadherin-like 26 |
| Genbank accession: | NM_021810.3 |
| Immunogen: | CDH26 (NP_068582.2, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS |
| Protein accession: | NP_068582.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CDH26 monoclonal antibody (M04), clone 6C10. Western Blot analysis of CDH26 expression in HeLa. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |