No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00060436-M20 |
Product name: | TGIF2 monoclonal antibody (M20), clone 2F5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TGIF2. |
Clone: | 2F5 |
Isotype: | IgG2a Kappa |
Gene id: | 60436 |
Gene name: | TGIF2 |
Gene alias: | - |
Gene description: | TGFB-induced factor homeobox 2 |
Genbank accession: | BC012816 |
Immunogen: | TGIF2 (AAH12816, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ |
Protein accession: | AAH12816 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TGIF2 monoclonal antibody (M20), clone 2F5. Western Blot analysis of TGIF2 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |