No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00060436-M18 |
| Product name: | TGIF2 monoclonal antibody (M18), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant TGIF2. |
| Clone: | 2F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 60436 |
| Gene name: | TGIF2 |
| Gene alias: | - |
| Gene description: | TGFB-induced factor homeobox 2 |
| Genbank accession: | BC012816 |
| Immunogen: | TGIF2 (AAH12816, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ |
| Protein accession: | AAH12816 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | TGIF2 monoclonal antibody (M18), clone 2F3. Western Blot analysis of TGIF2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |