Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 636,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 636,00 €
Data sheet of TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00060436-D01P |
| Product name: | TGIF2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TGIF2 protein. |
| Gene id: | 60436 |
| Gene name: | TGIF2 |
| Gene alias: | - |
| Gene description: | TGFB-induced factor homeobox 2 |
| Genbank accession: | NM_021809.4 |
| Immunogen: | TGIF2 (NP_068581.1, 1 a.a. ~ 237 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ |
| Protein accession: | NP_068581.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TGIF2 expression in transfected 293T cell line (H00060436-T01) by TGIF2 MaxPab polyclonal antibody. Lane 1: TGIF2 transfected lysate(25.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Differential roles of TGIF family genes in mammalian reproduction.Hu Y, Yu H, Shaw G, Renfree MB, Pask AJ. BMC Dev Biol. 2011 Sep 29;11:58. |