| Brand: | Abnova |
| Reference: | H00060412-M06 |
| Product name: | EXOC4 monoclonal antibody (M06), clone 4F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EXOC4. |
| Clone: | 4F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 60412 |
| Gene name: | EXOC4 |
| Gene alias: | MGC27170|REC8|SEC8|SEC8L1|Sec8p |
| Gene description: | exocyst complex component 4 |
| Genbank accession: | NM_021807 |
| Immunogen: | EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD |
| Protein accession: | NP_068579 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | EXOC4 monoclonal antibody (M06), clone 4F1 Western Blot analysis of EXOC4 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H. Eur J Oral Sci. 2012 Apr;120(2):123-31. doi: 10.1111/j.1600-0722.2012.00952.x. |