Brand: | Abnova |
Reference: | H00060401-M11 |
Product name: | EDA2R monoclonal antibody (M11), clone 2A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDA2R. |
Clone: | 2A10 |
Isotype: | IgG2b Kappa |
Gene id: | 60401 |
Gene name: | EDA2R |
Gene alias: | EDA-A2R|EDAA2R|TNFRSF27|XEDAR |
Gene description: | ectodysplasin A2 receptor |
Genbank accession: | BC034919.1 |
Immunogen: | EDA2R (AAH34919.1, 2 a.a. ~ 135 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Immunogen sequence/protein sequence: | DCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQ |
Protein accession: | AAH34919.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |