| Brand: | Abnova |
| Reference: | H00060401-M02 |
| Product name: | EDA2R monoclonal antibody (M02), clone 3C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EDA2R. |
| Clone: | 3C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 60401 |
| Gene name: | EDA2R |
| Gene alias: | EDA-A2R|EDAA2R|TNFRSF27|XEDAR |
| Gene description: | ectodysplasin A2 receptor |
| Genbank accession: | NM_021783 |
| Immunogen: | EDA2R (NP_068555, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQ |
| Protein accession: | NP_068555 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | EDA2R monoclonal antibody (M02), clone 3C1. Western Blot analysis of EDA2R expression in Raw 264.7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |