Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr,Flow Cyt |
Brand: | Abnova |
Reference: | H00060401-B01P |
Product name: | EDA2R purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human EDA2R protein. |
Gene id: | 60401 |
Gene name: | EDA2R |
Gene alias: | EDA-A2R|EDAA2R|TNFRSF27|XEDAR |
Gene description: | ectodysplasin A2 receptor |
Genbank accession: | NM_021783 |
Immunogen: | EDA2R (NP_068555.1, 1 a.a. ~ 297 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP |
Protein accession: | NP_068555.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EDA2R expression in transfected 293T cell line (H00060401-T02) by EDA2R MaxPab polyclonal antibody. Lane 1: EDA2R transfected lysate(32.67 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,Flow Cyt |
Shipping condition: | Dry Ice |