EDA2R purified MaxPab mouse polyclonal antibody (B01P) View larger

EDA2R purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDA2R purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr,Flow Cyt

More info about EDA2R purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00060401-B01P
Product name: EDA2R purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human EDA2R protein.
Gene id: 60401
Gene name: EDA2R
Gene alias: EDA-A2R|EDAA2R|TNFRSF27|XEDAR
Gene description: ectodysplasin A2 receptor
Genbank accession: NM_021783
Immunogen: EDA2R (NP_068555.1, 1 a.a. ~ 297 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
Protein accession: NP_068555.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060401-B01P-13-15-1.jpg
Application image note: Western Blot analysis of EDA2R expression in transfected 293T cell line (H00060401-T02) by EDA2R MaxPab polyclonal antibody.

Lane 1: EDA2R transfected lysate(32.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,Flow Cyt
Shipping condition: Dry Ice

Reviews

Buy EDA2R purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart