No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00060312-M03 |
Product name: | AFAP monoclonal antibody (M03), clone 3B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AFAP. |
Clone: | 3B12 |
Isotype: | IgG2a Kappa |
Gene id: | 60312 |
Gene name: | AFAP1 |
Gene alias: | AFAP|AFAP-110|FLJ56849 |
Gene description: | actin filament associated protein 1 |
Genbank accession: | NM_021638 |
Immunogen: | AFAP (NP_067651, 458 a.a. ~ 558 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKN |
Protein accession: | NP_067651 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |