Brand: | Abnova |
Reference: | H00059352-A01 |
Product name: | LGR6 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant LGR6. |
Gene id: | 59352 |
Gene name: | LGR6 |
Gene alias: | FLJ14471|GPCR|VTS20631 |
Gene description: | leucine-rich repeat-containing G protein-coupled receptor 6 |
Genbank accession: | NM_021636 |
Immunogen: | LGR6 (NP_067649, 403 a.a. ~ 496 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPT |
Protein accession: | NP_067649 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.45 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Reagent Including Anti-LGR6 Antibodies for Detection and Diagnosis of Cancer.Satofuka H, Murakami Y. United States Patent Application. 2016 Apr 28. US20160116478A1 |