LGR6 polyclonal antibody (A01) View larger

LGR6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LGR6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LGR6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00059352-A01
Product name: LGR6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LGR6.
Gene id: 59352
Gene name: LGR6
Gene alias: FLJ14471|GPCR|VTS20631
Gene description: leucine-rich repeat-containing G protein-coupled receptor 6
Genbank accession: NM_021636
Immunogen: LGR6 (NP_067649, 403 a.a. ~ 496 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPT
Protein accession: NP_067649
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00059352-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.45 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Reagent Including Anti-LGR6 Antibodies for Detection and Diagnosis of Cancer.Satofuka H, Murakami Y.
United States Patent Application. 2016 Apr 28. US20160116478A1

Reviews

Buy LGR6 polyclonal antibody (A01) now

Add to cart