| Brand: | Abnova |
| Reference: | H00059286-M01 |
| Product name: | UBL5 monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBL5. |
| Clone: | 2F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 59286 |
| Gene name: | UBL5 |
| Gene alias: | FLJ46917|HUB1|MGC131795 |
| Gene description: | ubiquitin-like 5 |
| Genbank accession: | NM_024292 |
| Immunogen: | UBL5 (NP_077268, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
| Protein accession: | NP_077268 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human UBL5 protein interacts with coilin and meets the Cajal bodies.Surnamesveda G, Surnamecastoralova G, Surnamelipov G, Surnameruml G, Surnameknejzlik G Biochem Biophys Res Commun. 2013 May 30. pii: S0006-291X(13)00890-5. doi: 10.1016/j.bbrc.2013.05.083. |