No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00058985-M01 |
| Product name: | IL22RA1 monoclonal antibody (M01), clone 2E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL22RA1. |
| Clone: | 2E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 58985 |
| Gene name: | IL22RA1 |
| Gene alias: | CRF2-9|IL22R|IL22R1 |
| Gene description: | interleukin 22 receptor, alpha 1 |
| Genbank accession: | NM_021258 |
| Immunogen: | IL22RA1 (NP_067081, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT |
| Protein accession: | NP_067081 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of IL22RA1 expression in transfected 293T cell line by IL22RA1 monoclonal antibody (M01), clone 2E6. Lane 1: IL22RA1 transfected lysate (Predicted MW: 63.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |