MPP4 polyclonal antibody (A01) View larger

MPP4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPP4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MPP4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00058538-A01
Product name: MPP4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MPP4.
Gene id: 58538
Gene name: MPP4
Gene alias: ALS2CR5|DLG6
Gene description: membrane protein, palmitoylated 4 (MAGUK p55 subfamily member 4)
Genbank accession: NM_033066
Immunogen: MPP4 (NP_149055, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MIQSDKGADPPDKKDMKLSTATNPQNGLSQILRLVLQELSLFYSRDVNGVCLLYDLLHSPWLQALLKIYDCLQEFKEKKLVPATPHAQVLSYEVVELLRETPTSPEIQE
Protein accession: NP_149055
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058538-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058538-A01-1-25-1.jpg
Application image note: MPP4 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of MPP4 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MPP4 polyclonal antibody (A01) now

Add to cart