| Brand: | Abnova |
| Reference: | H00058529-M05 |
| Product name: | MYOZ1 monoclonal antibody (M05), clone 1E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYOZ1. |
| Clone: | 1E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 58529 |
| Gene name: | MYOZ1 |
| Gene alias: | CS-2|FATZ|MYOZ |
| Gene description: | myozenin 1 |
| Genbank accession: | NM_021245 |
| Immunogen: | MYOZ1 (NP_067068.1, 200 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE |
| Protein accession: | NP_067068.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MYOZ1 monoclonal antibody (M05), clone 1E8. Western Blot analysis of MYOZ1 expression in HepG2. (34-kDa,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605603) |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |