No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00058529-M05 |
Product name: | MYOZ1 monoclonal antibody (M05), clone 1E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MYOZ1. |
Clone: | 1E8 |
Isotype: | IgG2a Kappa |
Gene id: | 58529 |
Gene name: | MYOZ1 |
Gene alias: | CS-2|FATZ|MYOZ |
Gene description: | myozenin 1 |
Genbank accession: | NM_021245 |
Immunogen: | MYOZ1 (NP_067068.1, 200 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE |
Protein accession: | NP_067068.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MYOZ1 monoclonal antibody (M05), clone 1E8. Western Blot analysis of MYOZ1 expression in HepG2. (34-kDa,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605603) |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |