MYOZ1 monoclonal antibody (M05), clone 1E8 View larger

MYOZ1 monoclonal antibody (M05), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYOZ1 monoclonal antibody (M05), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MYOZ1 monoclonal antibody (M05), clone 1E8

Brand: Abnova
Reference: H00058529-M05
Product name: MYOZ1 monoclonal antibody (M05), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant MYOZ1.
Clone: 1E8
Isotype: IgG2a Kappa
Gene id: 58529
Gene name: MYOZ1
Gene alias: CS-2|FATZ|MYOZ
Gene description: myozenin 1
Genbank accession: NM_021245
Immunogen: MYOZ1 (NP_067068.1, 200 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE
Protein accession: NP_067068.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058529-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058529-M05-1-12-1.jpg
Application image note: MYOZ1 monoclonal antibody (M05), clone 1E8. Western Blot analysis of MYOZ1 expression in HepG2. (34-kDa,http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=605603)
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYOZ1 monoclonal antibody (M05), clone 1E8 now

Add to cart