MID1IP1 purified MaxPab mouse polyclonal antibody (B01P) View larger

MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00058526-B01P
Product name: MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MID1IP1 protein.
Gene id: 58526
Gene name: MID1IP1
Gene alias: FLJ10386|G12-like|MIG12|STRAIT11499|THRSPL
Gene description: MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))
Genbank accession: NM_021242
Immunogen: MID1IP1 (NP_067065, 1 a.a. ~ 183 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
Protein accession: NP_067065
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058526-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MID1IP1 expression in transfected 293T cell line (H00058526-T01) by MID1IP1 MaxPab polyclonal antibody.

Lane 1: MID1IP1 transfected lysate(20.13 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MID1IP1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart