Cart 39 Product Products 16 628,07 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Prothrombi...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
16 628,07 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 39 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 628,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 628,07 €
Data sheet of FAM60A purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about FAM60A purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00058516-B02P |
| Product name: | FAM60A purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FAM60A protein. |
| Gene id: | 58516 |
| Gene name: | FAM60A |
| Gene alias: | C12orf14|L4|TERA |
| Gene description: | family with sequence similarity 60, member A |
| Genbank accession: | NM_021238 |
| Immunogen: | FAM60A (NP_067061.1, 1 a.a. ~ 221 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW |
| Protein accession: | NP_067061.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FAM60A expression in transfected 293T cell line (H00058516-T01) by FAM60A MaxPab polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |