Brand: | Abnova |
Reference: | H00058515-A01 |
Product name: | SELK polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SELK. |
Gene id: | 58515 |
Gene name: | SELK |
Gene alias: | HSPC030|HSPC297|MGC17057 |
Gene description: | selenoprotein K |
Genbank accession: | NM_021237 |
Immunogen: | SELK (NP_067060, 39 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | KTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG |
Protein accession: | NP_067060 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.94 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |