SELK polyclonal antibody (A01) View larger

SELK polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SELK polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SELK polyclonal antibody (A01)

Brand: Abnova
Reference: H00058515-A01
Product name: SELK polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SELK.
Gene id: 58515
Gene name: SELK
Gene alias: HSPC030|HSPC297|MGC17057
Gene description: selenoprotein K
Genbank accession: NM_021237
Immunogen: SELK (NP_067060, 39 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG
Protein accession: NP_067060
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058515-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SELK polyclonal antibody (A01) now

Add to cart