Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of DNASE2B polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about DNASE2B polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00058511-A01 |
| Product name: | DNASE2B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DNASE2B. |
| Gene id: | 58511 |
| Gene name: | DNASE2B |
| Gene alias: | DLAD |
| Gene description: | deoxyribonuclease II beta |
| Genbank accession: | NM_021233 |
| Immunogen: | DNASE2B (NP_067056, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK |
| Protein accession: | NP_067056 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Coordinated and sequential activation of neutral and acidic DNases during interdigital cell death in the embryonic limb.Montero JA, Lorda-Diez CI, Certal AC, Moreno N, Rodriguez-Leon J, Torriglia A, Hurle JM. Apoptosis. 2010 Jul 8. [Epub ahead of print] |