Cart 3 Product Products 1 177,07 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 177,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 177,07 €
Data sheet of MYL7 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MYL7 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00058498-B01P |
| Product name: | MYL7 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MYL7 protein. |
| Gene id: | 58498 |
| Gene name: | MYL7 |
| Gene alias: | MYL2A|MYLC2A |
| Gene description: | myosin, light chain 7, regulatory |
| Genbank accession: | NM_021223.2 |
| Immunogen: | MYL7 (NP_067046.1, 1 a.a. ~ 175 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE |
| Protein accession: | NP_067046.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MYL7 expression in transfected 293T cell line (H00058498-T01) by MYL7 MaxPab polyclonal antibody. Lane 1: MYL7 transfected lysate(19.25 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |