LY6G5B MaxPab mouse polyclonal antibody (B01) View larger

LY6G5B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY6G5B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LY6G5B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00058496-B01
Product name: LY6G5B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LY6G5B protein.
Gene id: 58496
Gene name: LY6G5B
Gene alias: C6orf19|G5b
Gene description: lymphocyte antigen 6 complex, locus G5B
Genbank accession: NM_021221.2
Immunogen: LY6G5B (NP_067044.2, 1 a.a. ~ 201 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
Protein accession: NP_067044.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058496-B01-13-15-1.jpg
Application image note: Western Blot analysis of LY6G5B expression in transfected 293T cell line (H00058496-T01) by LY6G5B MaxPab polyclonal antibody.

Lane 1: LY6G5B transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LY6G5B MaxPab mouse polyclonal antibody (B01) now

Add to cart