| Brand: | Abnova |
| Reference: | H00058488-M03A |
| Product name: | PCTP monoclonal antibody (M03A), clone 3A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCTP. |
| Clone: | 3A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 58488 |
| Gene name: | PCTP |
| Gene alias: | STARD2 |
| Gene description: | phosphatidylcholine transfer protein |
| Genbank accession: | NM_021213 |
| Immunogen: | PCTP (NP_067036, 106 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT |
| Protein accession: | NP_067036 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCTP monoclonal antibody (M03A), clone 3A11 Western Blot analysis of PCTP expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |