No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00058485-B01P |
Product name: | TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TRAPPC1 protein. |
Gene id: | 58485 |
Gene name: | TRAPPC1 |
Gene alias: | BET5|MUM2 |
Gene description: | trafficking protein particle complex 1 |
Genbank accession: | NM_021210 |
Immunogen: | TRAPPC1 (NP_067033.1, 1 a.a. ~ 145 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG |
Protein accession: | NP_067033.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TRAPPC1 expression in transfected 293T cell line (H00058485-T01) by TRAPPC1 MaxPab polyclonal antibody. Lane 1: TRAPPC1 transfected lysate(15.95 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |