Brand: | Abnova |
Reference: | H00058478-D01P |
Product name: | ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ENOPH1 protein. |
Gene id: | 58478 |
Gene name: | ENOPH1 |
Gene alias: | DKFZp586M0524|E1|FLJ12594|MASA|MST145 |
Gene description: | enolase-phosphatase 1 |
Genbank accession: | NM_021204 |
Immunogen: | ENOPH1 (NP_067027.1, 1 a.a. ~ 261 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST |
Protein accession: | NP_067027.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | ENOPH1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENOPH1 expression in human colon. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |