| Brand: | Abnova |
| Reference: | H00058155-M09 |
| Product name: | PTBP2 monoclonal antibody (M09), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTBP2. |
| Clone: | 2B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 58155 |
| Gene name: | PTBP2 |
| Gene alias: | FLJ34897|PTB|PTBLP|brPTB|nPTB|nPTB5|nPTB6|nPTB7|nPTB8 |
| Gene description: | polypyrimidine tract binding protein 2 |
| Genbank accession: | BC016582 |
| Immunogen: | PTBP2 (AAH16582.1, 35 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP |
| Protein accession: | AAH16582.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.25 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Specificity: | This antibody cross-reacts with human PTBP1. |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTBP2 monoclonal antibody (M09), clone 2B11. Western Blot analysis of PTBP2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |