Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LSM2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LSM2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057819-A01 |
| Product name: | LSM2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LSM2. |
| Gene id: | 57819 |
| Gene name: | LSM2 |
| Gene alias: | C6orf28|G7b|YBL026W|snRNP |
| Gene description: | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Genbank accession: | NM_021177 |
| Immunogen: | LSM2 (NP_067000, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
| Protein accession: | NP_067000 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LSM2 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of LSM2 expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.Lin SJ, Chang KP, Hsu CW, Chi LM, Chien KY, Liang Y, Tsai MH, Lin YT, Yu JS J Proteomics. 2013 Sep 27;94C:186-201. doi: 10.1016/j.jprot.2013.09.013. |