| Brand: | Abnova |
| Reference: | H00057817-M02 |
| Product name: | HAMP monoclonal antibody (M02), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HAMP. |
| Clone: | 1F9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57817 |
| Gene name: | HAMP |
| Gene alias: | HEPC|HEPCIDIN|HFE2B|LEAP-1|LEAP1|PLTR |
| Gene description: | hepcidin antimicrobial peptide |
| Genbank accession: | BC020612 |
| Immunogen: | HAMP (AAH20612, 25 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT |
| Protein accession: | AAH20612 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HAMP is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |