| Brand: | Abnova |
| Reference: | H00057804-M01A |
| Product name: | POLD4 monoclonal antibody (M01A), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POLD4. |
| Clone: | 2B11 |
| Isotype: | IgG2b kappa |
| Gene id: | 57804 |
| Gene name: | POLD4 |
| Gene alias: | POLDS|p12 |
| Gene description: | polymerase (DNA-directed), delta 4 |
| Genbank accession: | BC001334 |
| Immunogen: | POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL |
| Protein accession: | AAH01334 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (29.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POLD4 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Replication stress activates DNA repair synthesis in mitosis.Minocherhomji S, Ying S, Bjerregaard VA, Bursomanno S, Aleliunaite A, Wu W, Mankouri HW, Shen H, Liu Y, Hickson ID. Nature. 2015 Dec 2. |