Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GATAD1 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about GATAD1 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00057798-B01 |
| Product name: | GATAD1 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GATAD1 protein. |
| Gene id: | 57798 |
| Gene name: | GATAD1 |
| Gene alias: | FLJ22489|FLJ40695|ODAG|RG083M05.2 |
| Gene description: | GATA zinc finger domain containing 1 |
| Genbank accession: | NM_021167.3 |
| Immunogen: | GATAD1 (NP_066990.3, 1 a.a. ~ 269 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESVANHL |
| Protein accession: | NP_066990.3 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GATAD1 expression in transfected 293T cell line (H00057798-T02) by GATAD1 MaxPab polyclonal antibody. Lane 1: GATAD1 transfected lysate(28.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |